USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
$0.00
U-Cut "Bullet" Skirts
U-Cut "Bullet" Skirts U-Cut "Bullet" Skirts U-Cut "Bullet" Skirts U-Cut "Bullet" Skirts U-Cut "Bullet" Skirts U-Cut "Bullet" Skirts U-Cut "Bullet" Skirts U-Cut "Bullet" Skirts U-Cut "Bullet" Skirts U-Cut "Bullet" Skirts

U-Cut "Bullet" Skirts

$30.00 inc. tax
Ready-to-Ship!

This popular skirt style is known for its flattering design that lengthens the lines of a dancer's legs.


Product Code: 11118
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Customer Reviews

No Reviews Posted Yet - be the first!

write review
Related Products
Simple Ballet Skirt
Simple Ballet Skirt
$25.00
Ingrid- High/Low Cut Sh..
Ingrid- High/Low Cut Sh..
$30.00
Classic U-Cut
Classic U-Cut "Bullet" ..
$30.00
Ashton- Rehearsal Skirt
Ashton- Rehearsal Skirt
$45.00
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i