USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
$0.00
Classic U-Cut "Bullet" Skirt
Classic U-Cut "Bullet" Skirt Classic U-Cut "Bullet" Skirt Classic U-Cut "Bullet" Skirt Classic U-Cut "Bullet" Skirt

Classic U-Cut "Bullet" Skirt

$30.00 inc. tax
This popular skirt style is known for its flattering design that lengthens the lines of a dancer's legs.

Different colors may be requested at no extra cost - request a color swatch- made to order
Product Code: 11115
Product Condition: New
Related Products
Margot- The Shirt Skirt
Margot- The Shirt Skirt
$30.00
Ingrid- High/Low Cut Sh..
Ingrid- High/Low Cut Sh..
$30.00
Kathryn- Modest Pull On..
Kathryn- Modest Pull On..
$30.00
Ashton- Rehearsal Skirt
Ashton- Rehearsal Skirt
$45.00
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i